SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|84858|fgeneshDP_pg.C_scaffold_549000006 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|84858|fgeneshDP_pg.C_scaffold_549000006
Domain Number 1 Region: 24-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.79e-38
Family IMD domain 0.02
Further Details:      
 
Domain Number 2 Region: 310-368
Classification Level Classification E-value
Superfamily SH3-domain 8.79e-18
Family SH3-domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|84858|fgeneshDP_pg.C_scaffold_549000006
Sequence length 368
Sequence
MSGNTKKQQNPVIEITLKTINNLKVNSPPLFSEVIKAANKYQQQSQMLSQTGLVLADTIQ
RLTIHNSGDFGEGFKKLADAVRDLENKRDEVCKVLLNEFITPNKQAVENDQKDIVTFEKN
YKKDRDSMRQEILKLEAKTRKAGKKTTPEVLKQQITELNDKIKESEQLNANKLRDVVLME
RKKHATFLSQFNQFLEKEIELATESIAKYSTALNTHRELINTQSQLPSETESMISKQERT
LVQIQPQQGDSSNGDYRISYAPGTVQADSTYESYDSYDNYDNYDNYDQSYTDSGYDQQQQ
YGDQQQYGGTELQARALYDYDSHEPTDLCLRAGEILSILQQDDGSGWSKGRNSNGMEGIF
PSSYIEYV
Download sequence
Identical sequences F1A3Y9
jgi|Dicpu1|84858|fgeneshDP_pg.C_scaffold_549000006 XP_003294384.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]