SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|87126|fgeneshDP_pm.C_scaffold_69000005 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|87126|fgeneshDP_pm.C_scaffold_69000005
Domain Number 1 Region: 14-122
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-24
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 178-281
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.01e-19
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|87126|fgeneshDP_pm.C_scaffold_69000005
Sequence length 401
Sequence
MGSATITDQERSQVAFVAGSSTDVHSTTVARLYEGRQGRWDFMAVGIVSLVSNRVDKTNF
IKMFDLKANYRIIFEQEIYDSFDYQKHKEFFFTFEGDSAVYGLSFADVTEAAEFYGQLLN
CKQGNIGKTAAVNPNVSSGKLTTPTASAKADKKKEKKGFMAKFFSSETEKELEISAPTNF
KHESHIGWDPENGFDIKNIPPDWRKLFQSAGIKKSELKNAETAKFIVDIIGEQMVGAAPP
VPAQPGRSAPPPPAPVASQPGRSAPPPPPAPGKSAPPPPPPPQHHHQSPPPSTPGAPPPP
PPPPAPGAPPPPPPPAFGSSTTTTATSNGGSGGRADLLASIRSGTSLKTVDKSQPLPDIQ
SLGNEGNRSLVDTLAAAMANRRGNMREDESDDEDDEEWSDY
Download sequence
Identical sequences F0ZG66
XP_003286406.1.95606 jgi|Dicpu1|87126|fgeneshDP_pm.C_scaffold_69000005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]