SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma03g26060.1|PACid:16252362 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma03g26060.1|PACid:16252362
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Cupredoxins 2.26e-33
Family Plastocyanin/azurin-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma03g26060.1|PACid:16252362
Sequence length 187
Sequence
MASAIAASFLVLLLAFPTVFGADHEVGDTSGWALGVNYNTWASGKTFTVGDTLVFKYDST
HQVDEVDESGYNSCSSSNSIKNYQDGNSKIELTSPGKRYFLCPISGHCAGGMKLQINVAA
ASGTPPTTPSGTPPTTPSNPSPSPPSESGSTNTTSPPKPSGAVTVSSGIGLLVGSFFVSA
IMFGFMG
Download sequence
Identical sequences A0A0R0KHF0
Glyma03g26060.1|PACid:16252362 XP_003521063.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]