SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma03g30520.1|PACid:16252852 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma03g30520.1|PACid:16252852
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-37
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma03g30520.1|PACid:16252852
Sequence length 199
Sequence
MYLHEGCQRRIIHRDITAANILLTENFEPQICDFGLAKWLPENWTHHIVSKIEGTFGYLT
PEYLLHGIVDEKTDVFAFGVVLLELVTGRRALDHSQQSLVLWAKPLLKKNCIRELIDPSL
ADDFDCRQIKIMLLAASLCIQQSSIRRPSMKQASSLVLLKFQLNVVQLLNGNLSCFKFTK
KSQHPLFRKVFQEELLDAD
Download sequence
Identical sequences Glyma03g30520.1|PACid:16252852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]