SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma04g03970.1|PACid:16254785 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g03970.1|PACid:16254785
Domain Number 1 Region: 8-207
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.19e-47
Family Patatin 0.000000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma04g03970.1|PACid:16254785
Sequence length 207
Sequence
IQPPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGG
IVTAMLTAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLRSLGGPKYNGKY
LQEVVREKVGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICISTSA
APTYLPAYHFNNKDSEGNMHQFNLIDG
Download sequence
Identical sequences Glyma04g03970.1|PACid:16254785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]