SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma08g45530.1|PACid:16273931 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma08g45530.1|PACid:16273931
Domain Number 1 Region: 26-132
Classification Level Classification E-value
Superfamily STI-like 4.49e-29
Family Kunitz (STI) inhibitors 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma08g45530.1|PACid:16273931
Sequence length 134
Sequence
MKSTIFFALFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTG
NERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV
VEDLPEGPAVKIAS
Download sequence
Identical sequences Glyma08g45530.1|PACid:16273931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]