SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma11g37410.1|PACid:16285702 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma11g37410.1|PACid:16285702
Domain Number 1 Region: 134-688
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.17e-103
Family Neurolysin-like 0.0000000189
Further Details:      
 
Weak hits

Sequence:  Glyma11g37410.1|PACid:16285702
Domain Number - Region: 44-67,99-153
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0129
Family Nuclear receptor ligand-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma11g37410.1|PACid:16285702
Sequence length 695
Sequence
MGKEKRRGIILAFTGAAAVLAIAANLAITAIKYQKAKNAKKKGSMVRVNLSASEILKLAE
QIIANSNKVHNSVASVPLDKKRRHSLFHWRNNLRAIEAFCSLSNFAIGSRLRMQMLYHLW
QNCKRSNSHWSSVFPKMVSTREDVRKASAEAVRRLDAHFDTCSKREDVYLVIKAFAVTKN
QGVLWNVRDFERNGLNLTASKREELQRLRDQIDELSFKYIQNLNDDSRFILFTKAELAGL
PPEFLKGLDKSDNGKFKISLRSHHVAAVLEFCKVGTTRQVVSGAYGNRCGEINVSILERL
VQQRHKYARLLGYSCYAEYVIDVRMAKTPKKVFEFLKDISTSLTGLALKELNILKDVKKK
EEGEFPFGIEDLLYYVKRVEEQDYDLDFGEIKQYLPISVVLSGIFKIIQDLFVLDLGSGE
LLGYCYLDLFSREGKYGHTCVLALQNSALTSSGAHQIPVALLISQCQKDADGSSGLLRFS
EVVSLFHEFGHVVQQICNRASFTRISGLCVDADFVEIPAQLLENWCYESYSLKLISGFHQ
DITKPLTDDICKSIKRWRTSFSALKLKQDILCCLFDQIIHSADNIDIQELFKYLHPMEML
GLPILEGTNPASYFPSTVVGYEAACYSRIWSEVFAADIFTSKFCNDVSNQQAGMQFRNKV
LASAGVKDPIDVLLDFLGREPSIQAYIENKVKYVL
Download sequence
Identical sequences Glyma11g37410.1|PACid:16285702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]