SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma12g13130.1|PACid:16287333 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g13130.1|PACid:16287333
Domain Number 1 Region: 23-124
Classification Level Classification E-value
Superfamily Cupredoxins 1.59e-34
Family Plastocyanin/azurin-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma12g13130.1|PACid:16287333
Sequence length 178
Sequence
MAFHRFLGLLILMTPIMFVQVVARQFDVGGKDGWVLKPTEDYDHWAQRNRFQVNDTLHFK
YNKGSDSVVVVKKEDFDSCNINNPIQKMDGGDSTFQLSNSGLFYFISGNLDNCKNGQKLI
VLVMAARQPIPRAALPPQKIPATSLTSPAPTPTDNSGSGRVGVSVGIVLMFTGFVGLV
Download sequence
Identical sequences I1LS50
Glyma12g13130.1|PACid:16287333 XP_003540921.2.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]