SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma12g17240.1|PACid:16287747 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma12g17240.1|PACid:16287747
Domain Number 1 Region: 33-112
Classification Level Classification E-value
Superfamily IpsF-like 1.44e-31
Family IpsF-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma12g17240.1|PACid:16287747
Sequence length 113
Sequence
PVSISVSAASTPTPSSIQVDKSPVSATPSKLLPFRIGHGFDLHRLEPGYPLIIGGINVPH
NRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGCASSVFIHEF
Download sequence
Identical sequences Glyma12g17240.1|PACid:16287747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]