SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma18g30690.1|PACid:16309436 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma18g30690.1|PACid:16309436
Domain Number 1 Region: 13-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-26
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma18g30690.1|PACid:16309436
Sequence length 232
Sequence
MAATFPQQLLVKPIHFFKIITAHNVHEGKLMIPNKFVKKYGKRLQNTLFLKTPNGAEWKM
ILKKRDGKIWFQKGWKEFAEYHSLAHGHLLVFRWDVTSHFQVHIFDLSALEIEYPTEIIK
GKTASNRKGNESPGDEHLECHRSGQKRKVNSVEFLQQCQMRSRKCVKVENTMILPRQALH
HTATKCKGKSKAMDNQVTALDRASSFKSCNPFFLTVMHRTHISSHGSLVSLK
Download sequence
Identical sequences Glyma18g30690.1|PACid:16309436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]