SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma20g06750.1|PACid:16315631 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma20g06750.1|PACid:16315631
Domain Number 1 Region: 411-534
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000362
Family Nuclear receptor ligand-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma20g06750.1|PACid:16315631
Sequence length 580
Sequence
MAPAGILSKLWSFISFLPFFFLLFILGIIKGALIGPIAFSIIVIGNSAVFIGLWSAHFVW
TYYCVARTNRFGLVFKLVVLMCLPIPLLLWPIVGIVGSLLGGIGYGFFAPLLATFQAVGK
GENVNQKFHHCFIDGCRSTIERSYTVVQDVTDFCFHSYFSYMDELRENLPHHEKPLDIQL
SLLPCCLLVIMVGVPLDMALITCIAIWKSPYMLFIGWKRLLEDLIGRKGPFLETECVPFA
GLAIILWPLAVVVAVLAATIFSLFLALYSGVVVHQEDSVKMGFAYIVSVVSLFDEYVNDL
LYLREGSCFPRPIYRRNKSHAIERKNLGGGDNDLRNWRDGSQNSKHAIQQSRSLKWRIQQ
YRPVQVWDWLFKSCEVNGRILLRDGLVSVGEVEECILKGNCKKLSIKLPAWSLLQCLLTS
AKSNSDGLVISDDVVLTRMNGPKDGVFEWFIGPLLIIKEQLKNLELEETEETCLKELVMK
CKNELPEEWDSTGFPSDDTVRRAQLQAIIRRLQGIVASMSRMPTFRRRFRNLIKVLYIEA
LQAGASASHIGGTLIPKHREKGSIQSKDNVDELDEPSNEC
Download sequence
Identical sequences I1NDU1
XP_003556769.1.40590 Glyma20g06750.1|PACid:16315631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]