SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma02g29360.1|PACid:16248780 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma02g29360.1|PACid:16248780
Domain Number 1 Region: 158-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 261-291
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000275
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 95-127
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000034
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 33-58
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000981
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma02g29360.1|PACid:16248780
Sequence length 295
Sequence
MDVRKRGRPDVNLNGAVKKTKQELESLSSGVGSKSKPCTKFFSTAGCPFGEGCHFLHYVP
GGYNVVAHMMNLKPAAPPPRTVAAPPPIPNGSAPSAVKTRICNKFNTAEGCKFGDKCHFA
HGEWELGKPIAPSIDDHHHHRPLGPPAGGRMAGRIEPPPAMAGSFGAISTAKISVEASLA
GAIIGKGGVNSKQICRQTGAKLSIREHESDPNLRNIELEGTFEQIKEASNMVKDLLLTVS
MSAPPKSTPGVPGAPAPPGSNFKTKLCENFAKGSCTFGERCHFAHGAAELRKSGV
Download sequence
Identical sequences I1JG21
Glyma02g29360.1|PACid:16248780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]