SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma04g03030.1|PACid:16254665 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma04g03030.1|PACid:16254665
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.22e-21
Family DNA-binding domain from rap30 0.0023
Further Details:      
 
Domain Number 2 Region: 12-122
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000000018
Family Rap30/74 interaction domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma04g03030.1|PACid:16254665
Sequence length 262
Sequence
MDEENGYSGSSSSNLETTKAERSVWLMKCPLVVAKSWQAHPPSQPLAKVVLSLDPLHPEE
DDPSAVQFTMEMAGSEAVNMPKTYSLNMFKDFVPMCVFSETSQGGKVAMEGKVEHKFDMK
PHGENIEEYGKLCRERTNKSMIKNRQIQVIDNDRGVLMRPMPGMIGLVSSNSKDKKKTQP
VKQSDTKRTRRDRGELEDIMFKLFERQPNWALKQLVQETDQPAQFLKEILNELCVYNKRG
ANQGTYELKPEYKKSVEDTSAE
Download sequence
Identical sequences C6TL77
Glyma04g03030.1|PACid:16254665 NP_001241605.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]