SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma06g03070.1|PACid:16261526 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma06g03070.1|PACid:16261526
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.22e-21
Family DNA-binding domain from rap30 0.0023
Further Details:      
 
Domain Number 2 Region: 12-122
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000000314
Family Rap30/74 interaction domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma06g03070.1|PACid:16261526
Sequence length 262
Sequence
MDEENGYSGSISSNLETTKAERSVWLMKCPLVVAKSWQTHPPSQPLAKVVLSLDPLHPEE
DDPSAVQFTMEMAGTEAVNMSKTYSLNMFKDFVPMCVFSETSQGGKVAMEGKVEHKFDMK
PHGENIEEYGKLCRERTNKSMIKNRQIQVIDNDRGVLMRPMPGMIGLVSSNSKDKKKTQP
VKQSDTKRTRRDRGELEDIMFKLFERQPNWALKQLVQETDQPAQFLKEILNELCVYNKRG
ANQGTYELKPEYKKSVEDTSAE
Download sequence
Identical sequences I1K7N0
XP_003527856.1.40590 Glyma06g03070.1|PACid:16261526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]