SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma14g40610.1|PACid:16297077 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma14g40610.1|PACid:16297077
Domain Number 1 Region: 725-1063,1166-1209
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.16e-71
Family FAD-linked reductases, N-terminal domain 0.0000483
Further Details:      
 
Domain Number 2 Region: 1045-1156
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.94e-28
Family L-aminoacid/polyamine oxidase 0.00045
Further Details:      
 
Domain Number 3 Region: 519-616
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000529
Family SWIRM domain 0.038
Further Details:      
 
Domain Number 4 Region: 1305-1391
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000141
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma14g40610.1|PACid:16297077
Sequence length 1744
Sequence
MDGEDIRSGTKKKRSKKEIGFDDDDEPIGSIFKLKRSKKKGSGGSSDAAVVREKEDLGGM
DDNDTLASFRKRLKGPKRDQGSGVTRGASPALHVSDEDLVALGPKGKDEKVVVPVPGDED
MQMQGCSDQQHMEDSLSAIFNKAQFSSTRKSRGRGSRQKRGIQNVDSEGFVETVDSVVGS
RSGSAFGSKLVGGNVESADALPQASEPVVASVVDDQKCGDDCFQEEAVKGNRNLDIPDGP
SQSSNVCHGYRQQLSCVQVGDISCHSDQKVGLQESVLSDGLNKLPTTSHDVSLSKVGEGK
RGFTEIGESENRLTDEQAKVCNSASEPDVSTSAGEKNVLTSCHTEPLIKSTENILNENNN
MVARKVFQESSCNGALKLSGCHMEVDGGGKSETEIVSDRNFCDYSSSDTKAEFIFYDPIQ
SDGSSLQSSIPDENGNSAEYCAPASDFADNEGKISSIPRAVRKAKMRKHGDMTYEGDADW
EILIDDQALNESQVMTDGDRTLRARLKHDSSLNTGEDSENVAVVAVSAGLKARKVGPIEK
IKFKEILKRKGGLKEYLDCRNQILSLWNRDVTRILPLAECGVSDTHSEHGSPRFSLIREV
YAFLDQYGYINVGIASQKENVGSSARHCYRLVKEKGFEESLAASMADPEDGVSFLVGQTK
MSDTSNEINNGLTKDCDDLTTEAAEGMRHANEMKTDLSNMTHQAERKKIDYQENDSDHLQ
SDLDPRKRVIVIGAGPAGLTAARHLQRQGFAVTVLEARSRIGGRVFTDHSSLSVPVDLGA
SIITGVEADVATERRPDPSSLICAQLGLELTVLNSDCPLYDIVTGQKVPADMDEALEAEY
NSLIDDMVLVVAQKGEQAMRMSLEDGLEYALKIRRMARSESSEETEQNNSADSPFDSKKD
STVEKKFGEEILSPQERRVMDWHFAHLEYGCAALLKDVSLPYWNQDDVYGGFGGAHCMIK
GGYSSVAESLGEGLTIHLNHVVTNVSYGIKEPGQNNKVKVSTANGNEFFGDAVLVTVPLG
CLKAETIQFSPPLPQWKCSSVQRLGYGVLNKVVLEFPSVFWDDAVDYFGATAEERSSRGH
CFMFWNVRKTVGAPVLISLVVGKAAIDGQSLSSYDHVNHALKVLRKLFGEDSVPDPVAYV
VTDWGRDPFSYGSYSYVAVGASGEDYDIIGRPVDNCLFFAGEATCKEHPDTVGGAMMSGL
REAVRIIDILSSGNDYIAEVEALEAARGQLDTERDEVRDIIKRLDALELSNIMYKNSLDG
AQILTREALLKEMFNNTKTTAGRLHVAKQLLTLPVGNLKSFAGSKEGLAILNSWILDSMG
KDGTQLLRHCLRLLVRVSTDLLAVRLSGMGKTVKEKVCVHTSRDIRAIASQLVNVWLEVF
RKEKASNASTAHVKKLHSKQGRQPAAYDSRHEVSSSRSKGSIDTVVAEKEDNLCTVSEEE
QAAIAAAEAARAKALAAAEAYASAEARCNTLLQLPKIPSFHKFARREQTSQNDEYDSRKR
WPGGVYGRQDCISEIDSRNCRVRDWSVDFSAACVNLDNSRMPVDNLSQRSHSNEIASHLN
FREHSGESVAGDSSIYTKAWIDTAGGIAIKDHHAIERWQSQAAAADSYFSNPTIHLKDEE
DSNACSKLPSWKHDGIANESSISQVTVSKEAQKGHSRGADHIKQAVVDYVASLLMPLYKA
RKLDKDGYKAIMKKSATKVMEQATDAEKAMAVREFLDFKRKNKIRSFVDVLIERHMTTKP
DMKS
Download sequence
Identical sequences Glyma14g40610.1|PACid:16297077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]