SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma17g37470.1|PACid:16307348 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma17g37470.1|PACid:16307348
Domain Number 1 Region: 478-816,919-962
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.26e-70
Family FAD-linked reductases, N-terminal domain 0.0000488
Further Details:      
 
Domain Number 2 Region: 798-909
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.18e-29
Family L-aminoacid/polyamine oxidase 0.00039
Further Details:      
 
Domain Number 3 Region: 276-373
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000896
Family SWIRM domain 0.036
Further Details:      
 
Domain Number 4 Region: 1058-1141
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000418
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma17g37470.1|PACid:16307348
Sequence length 1474
Sequence
MEGENIRSGTKKKRSKKEIGFDSDDDEPIGSMFKLKRSKKKGSGGGSSDAAVVREKEDLG
GMDDNDTLASFRKRLKGPKRDQGSGVTRGGAIPALHVSDEDLVALGPKARVRGRKRGFRI
SGSASGSKLVGGNVESVELLPQASERVVASVVDDQKCGDDCFQEEAVKGHCDLDIPDGPS
QSNNVCHGDMQQLSCVQVEDISCHSDQKGKISSIPRAVRKTKMRKHGDMTYEGDADWEIL
IDDQALNESQVMTDGDRTLRSRLKHDSSLNTGEDSENVAVVAVSAGLKARKAGPIEKIKF
KEVLKRKGGLKEYLDCRNQILSLWNRDVTRILPLAECGVSDTHSEDGSPRSSLIREVYAF
LDQYGYINVGIASQKENVGSNARHCYKLVKEKGFEESLAASMADSEDGVSFLVGQTKMSD
TSNEINNGLTKDGDDLTLEAAEGMRHANEMKTDLSNMTQQIDFSDARVGYHLQSDLDPRK
RVIVIGAGPAGLTAARHLERQGFSVFVLEARSRIGGRVFTDHLSLSVPVDLGASIITGVE
ADVATERRPDPSSLICAQLGLELTVLNSDCPLYDIVTGQKVPADMDEALEAEYNSLIDDM
VLVVAQKGEQAMRMSLEDGLEYALKIRRMARSESSEETEQNNSADSPFDSKKDSTLEKKL
GEEILSPQERRVMDWHFAHLEYGCAALLKDVSLPYWNQDDVYGGFGGAHCMIKGGYSSVV
ESLGEGLTVHLNHVVTNVSYGIKEPGQSNKVKVSTENGNEFFGDAVLVTVPLGCLKAETI
QFSPPLPQWKCSSVQRLGYGVLNKVVLEFPSVFWDDAVDYFGATAEERSSRGHCFMFWNV
RRTVGAPVLIALVVGKAAIDGQSLSSSDHVNHALKVLRKLFGEDSVPDPVAYVVTDWGRD
PFSYGSYSYVAVGASGEDYDIIGRPVDNCLFFAGEATCKEHPDTVGGAMMSGLREAVRMI
DILSSGNDYIAEVEALEAARGQLDTERDEVRDIIKRLDALELSNIMYKNSLDGAHILTRE
ALLREMFFNTKTTAGRLHVAKQLLTLPVGNLKSFAGSKEGLAILNSWILDSMGKDGTQLL
RHCLRLLVRVSTDLLAVRLSGMGKTVKEKVCVHTSRDIRAIASQLVNVWLEVFRKGKASN
GGLKISRQTSAVDLSKRKSEDNLCTISEEEQAAIAAAEAARAKALAAAEAYASAEARCNT
LLQLPKIPSFHKFARREQPSQNDECDSRKRWPGGVYGRQDCISEIDSRNCRVRDWSVDFS
AACVNLDNSRMPVDNLSQRSHSNEIASHLNFREHSGESVAGDSSIYTKAWIDTAGGIAIK
DHHAIERWQSQAAAADSYFSNPSIDLKDEEDSNACSKLPSWKRDGIANESSISQVTVNKE
AQKGHSRGADHIKQAVVDYVASLLMPLYKARKLDKDGYKAIMKKSETKVMEQATDAEKAM
TVREFLDFKRKNKIRSFVDVLIERHMTTKPDMKS
Download sequence
Identical sequences Glyma17g37470.1|PACid:16307348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]