SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Glyma19g32910.1|PACid:16313559 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma19g32910.1|PACid:16313559
Domain Number 1 Region: 158-240
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000129
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 260-291
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000144
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000034
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 35-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000102
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma19g32910.1|PACid:16313559
Sequence length 295
Sequence
MDTRKRGRPEPGFSLNGGFKKSKQEMESLSTGVGSKSKPCTKFFSTAGCPFGEGCHFLHY
VPGGYNAVAHMMNLTPAAPPASRNVAALPPVPNGSAPPAVKTRICNKFNTAEGCKFGDKC
HFAHGEWELGKHIAPSFDDHRTMGPTGVGRLAGRMEPPPGPAASFGANATAKISVEASLA
GAIIGKGGVNSKQICRQTGAKLSIREHESDPNLRNIELEGSFEQIKEASNMVKDLLLTLQ
MSAPPKTTPGVPGAPASHGSNFKTKLCENFTKGSCTFGDRCHFAHGAAELRKSGV
Download sequence
Identical sequences A0A0B2R2B2 I1N979
XP_006603730.1.40590 Glyma19g32910.1|PACid:16313559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]