SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Crypa1|74333|fgenesh1_pg.C_scaffold_9000048 from Cryphonectria parasitica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Crypa1|74333|fgenesh1_pg.C_scaffold_9000048
Domain Number 1 Region: 665-999
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.83e-70
Family PIWI domain 0.034
Further Details:      
 
Domain Number 2 Region: 493-575
Classification Level Classification E-value
Superfamily PAZ domain 8.48e-20
Family PAZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Crypa1|74333|fgenesh1_pg.C_scaffold_9000048
Sequence length 1045
Sequence
MSPCSRIRATAVVRTSSPPPAEGIIAGAEVLHLQEVMVGTVALQAVEVDTLKVVVSTTCL
SGGYQSGGPSHQASGGRGYSSSRGNYRGGGGSSNSSGGKVWKLNSVKRDAEAAEAEKRPY
RPAFGTGGQGVELWANYFPIKTLGSPKKLYRYSFAVYPVQEKKTAGQQKVADTSQRRETR
NASDGHGAQAGQSGSFSVLADTDTDEKITGKRIGAIFATAQDALTMGQVWATDYKETLVL
QQPLDFKDTEALPLLTVCRETATVQVHFPPSQVYKEDRRYDVRFQLDEEMDLGALFKDLS
NGNPPPEGFVKALSVIFGYAPLRDAKTRVLGAGRYFKDSREERQDLVCMSNPDIPKLMTI
LRGFVQNVRPATGKFLLNVNVTYGIFRPKINLGRLLWPRAALIWGSDEKQRLGDLEKLHG
IIQRTKILYKPPKKKGKPTDAQPNRSSVCTDQSHPGGPDDFVNRITIAGFARRKDSGQGK
QTDFPNWEQARCKDGDDDITVKQYFEKYYKIALKHPELPLINRGTPEAPDYIPAERCWLD
FGQARLAKIEQDDAAEMIRFACQRPFDNATKICNVGHAVLHLGSSNQTLQHFGLSVGNDL
LKVQGRELDAPLLAYRQSNVPGPATTLPAIQDFKMEMLRLGMKMGNALMTFNIKEGGEKH
IITGFHSFLKESKARGATLALIVFPYQQPSGVYNKIKFLGDVVHGLHTVCVIGRKFVKNG
QTQREYFANVSLKINLKLGGTNHQLTHPPELFRGTMVVGYDAVHPTAVEKEDLPSHMALV
ASVDEGLGQWSGCYWTQKRRQEIADATNLKQHMKSRLELWMKERRRRPERIIIYRDGVSD
SQYEAVMKDELPQIEAAYRDQFQGEEPKITLVVAVKRHSTRFYPSDPTHMTKSGNMRSGT
IVDRGITEARYWEFFLTAHEAIQGTARPARYVVLRDDIFRTKYKKDGLVKGHDFTEAVNK
LEEFTHKVCYLFGRATRAVSLCTPAYYADILCTRARAYESAIAHEPFKDMLGIRTRTVGA
AEDEELRRIREMKVHDDLKNSMFWI
Download sequence
Identical sequences jgi|Crypa1|74333|fgenesh1_pg.C_scaffold_9000048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]