SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A6ZSA6|A6ZSA6_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A6ZSA6|A6ZSA6_YEAS7
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-22
Family Ubiquitin-related 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A6ZSA6|A6ZSA6_YEAS7
Sequence length 73
Comment Conserved protein OS=Saccharomyces cerevisiae (strain YJM789) GN=HUB1
Sequence
MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDY
EVHDQTNLELYYL
Download sequence
Identical sequences A0A0L8VIX1 A6ZSA6 B3LPL1 C7GLM5 C8ZFR0 N1NXS3 Q6Q546
YNR032C-A YNR032C-A YNR032C-A YNR032c-a___KOG3493 YNR032C-A tr|A6ZSA6|A6ZSA6_YEAS7 NP_014430.1.97178 XP_015331724.1.40921 YNR032C-A YNR032C-A 000006125|e1m94A1|221.1.1.211|A:21-93 cath|current|1m94A00/1-73 d1m94a_ YNR032C-A YNR032C-A YNR032C-A YNR032C-A YNR032C-A YNR032C-A YNR032C-A YNR032C-A 4932.YNR032C-A YNR032C-A SCRT_03111 YNR032C-A APC6383 YTYst190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]