SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A6ZYW1|A6ZYW1_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A6ZYW1|A6ZYW1_YEAS7
Domain Number 1 Region: 248-340
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000735
Family Ubiquitin-related 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A6ZYW1|A6ZYW1_YEAS7
Sequence length 341
Comment Putative uncharacterized protein OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_1249
Sequence
MKESVVEINSSESDLDEDKNFPRSRSRSRSSIRSISPAGKYKRQKSSLLYTYDENDDFFK
ELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALD
GLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKE
YEKNFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELKNVEETQEI
KENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRI
QKQLPQKTRVKLLFDHDELDMNECIADQDMEDEDMVDVIID
Download sequence
Identical sequences A6ZYW1
YDR363W tr|A6ZYW1|A6ZYW1_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]