SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A7A0L9|A7A0L9_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7A0L9|A7A0L9_YEAS7
Domain Number 1 Region: 151-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.6e-34
Family Ubiquitin-related 0.0000257
Further Details:      
 
Domain Number 2 Region: 304-380
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.63e-34
Family Ubiquitin-related 0.0000284
Further Details:      
 
Domain Number 3 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.46e-34
Family Ubiquitin-related 0.0000257
Further Details:      
 
Domain Number 4 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.46e-34
Family Ubiquitin-related 0.0000257
Further Details:      
 
Domain Number 5 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.49e-33
Family Ubiquitin-related 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7A0L9|A7A0L9_YEAS7
Sequence length 381
Comment Poly-ubiquitin OS=Saccharomyces cerevisiae (strain YJM789) GN=UBI4
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGN
Download sequence
Identical sequences A0A060T7Q5 A0A202G3H6 A7A0L9 B3LTD4 C4YAP5 C8ZCT5 E7LX86 G2WIF8 P0CG63
NP_013061.1.97178 XP_002614495.1.3285 SCRT_04953 tr|A7A0L9|A7A0L9_YEAS7 YR271 YLL039C YLL039C 4932.YLL039C YLL039C YLL039C YLL039C YLL039C ORFP:15007 YLL039C CLUT_05273 YLL039C YLL039C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]