SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A7A160|A7A160_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7A160|A7A160_YEAS7
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.57e-67
Family Ubiquitin-related 0.0071
Further Details:      
 
Domain Number 2 Region: 100-150
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 8.3e-17
Family Ribosomal protein S27a 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7A160|A7A160_YEAS7
Sequence length 152
Comment Ribosomal protein S31 OS=Saccharomyces cerevisiae (strain YJM789) GN=RPS31
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAVLSYYKVDAEGKVTKLRRE
CSNPTCGAGVFLANHKDRLYCGKCHSVYKVNA
Download sequence
Identical sequences A0A0L8VKS9 A0A250WKS7 A7A160 B3RH62 C7GIV9 C8ZDE0 E7KG03 E7KRR4 E7LXM2 E7NKP0 E7Q6W6 E7QI19 G2WJ02 H0GKA6 N1P195 P05759
YLR167W YLR167W YLR167W YLR167W YLR167W YLR167W SCRT_04130 tr|A7A160|A7A160_YEAS7 YLR167W YLR167W 3j6x_31 3j6y_31 3j77_31 3j78_31 5juo_CC 5jup_CC 5jus_CC 5jut_CC 5juu_CC 5mc6_N 5ndg_E1 5ndg_e1 5wyj_Sg 6eml_N YLR167W YLR167W YLR167W YLR167W NP_013268.1.97178 YLR167W YLR167W YLR167W YLR167W 4932.YLR167W YLR167W YLR167W YLR167W YLR167W YLR167W YLR167W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]