SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A6ZM80|A6ZM80_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A6ZM80|A6ZM80_YEAS7
Domain Number 1 Region: 202-506
Classification Level Classification E-value
Superfamily TPR-like 9.1e-71
Family Tetratricopeptide repeat (TPR) 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A6ZM80|A6ZM80_YEAS7
Sequence length 514
Comment Conserved protein OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4192
Sequence
MNEVTCSITGDNPIHKINNGLGLKWNNLGKFSDFQTNDSAARDARTIDYIFTNCQTGSSI
GKIDFRAALPADKSQHSGVSEKEFSRLENQWSKEFSCFPKNKNADVTKPSRNKHEKRSAN
LHNRYFAQYYSTAYQQNRIYPCRISYNEHLSVSNGWEFQFKSIENQLLNELKIENNVEEK
TVGYEYVAEYEETIDFMHMLSSVPQTYQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVM
AFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQ
QNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLVHILESLLNMGIEKKDQY
DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC
KQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRSKGYEHNKAKMQNKFMQNLKNA
LIASKNFDSLDLINGSHNTESLISTLKAIYNKMD
Download sequence
Identical sequences A6ZM80
YMR018W YMR018W tr|A6ZM80|A6ZM80_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]