SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A6ZMP2|A6ZMP2_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A6ZMP2|A6ZMP2_YEAS7
Domain Number 1 Region: 24-69
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000849
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A6ZMP2|A6ZMP2_YEAS7
Sequence length 211
Comment Conserved protein OS=Saccharomyces cerevisiae (strain YJM789) GN=RGM1
Sequence
MRGKQPKRNKDNASVKRNYRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFS
RIDNLRQHQSSVHSDVDLMSLRRLQQSANSTANDPNATRMFPQLRPYGIVVQPAPVPYNL
PISTPASPQNTISLYAPPYFPHPMPSAPIPLPHQPPPLPIYSYMQPLFLNHTPIQNHNIV
ELPPDSSDTPASPSKVQSFDQAKDASPNAKK
Download sequence
Identical sequences A0A250WEB3 A6ZMP2 C7GTR9 G2WKN6 H0GL92
YMR182C YMR182C YMR182C tr|A6ZMP2|A6ZMP2_YEAS7 YMR182C YMR182C YMR182C YMR182C YMR182C YMR182C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]