SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A6ZY62|A6ZY62_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A6ZY62|A6ZY62_YEAS7
Domain Number 1 Region: 186-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.32e-25
Family Thioltransferase 0.00027
Further Details:      
 
Domain Number 2 Region: 30-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-24
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A6ZY62|A6ZY62_YEAS7
Sequence length 285
Comment Glutaredoxin OS=Saccharomyces cerevisiae (strain YJM789) GN=GRX3
Sequence
MCSFQVPSAFSFNYTSYCYKRHQARYYTAAKLFQEMPVIEINDQEQFTYLTTTAAGDKLI
VLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIH
KGTILKELSGADPKEFVSLLEDCKNSVNSGSSQTHTMENANVNEGSHNDEDDDDEEEEEE
TEEQINARLTKLVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVR
QNLKKFSEWPTFPQLYINGEFQGGLDIIKESLEEDPDFLQHALQS
Download sequence
Identical sequences A6ZY62 B3LGH6 B5VFZ7 C7GVP0 C8Z515 G2WAK2
YDR098C YDR098C YDR098C YDR098C YDR098C YDR098C YDR098C YDR098C YDR098C tr|A6ZY62|A6ZY62_YEAS7 YDR098C YDR098C YDR098C SCRT_00418 YDR098C YDR098C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]