SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A6ZZI8|A6ZZI8_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A6ZZI8|A6ZZI8_YEAS7
Domain Number - Region: 100-166,406-439
Classification Level Classification E-value
Superfamily TPR-like 0.000319
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A6ZZI8|A6ZZI8_YEAS7
Sequence length 463
Comment Conserved protein OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_3248
Sequence
MWKYLHRSVKNEGTVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGI
VSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAGNM
DPLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRD
LQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFK
GLPFIGKSKPDYQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRNNLSGA
LNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYTIDNEPYKKSEPLELI
RSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINL
HKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI
Download sequence
Identical sequences A6ZZI8
YKL133C tr|A6ZZI8|A6ZZI8_YEAS7 YKL133C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]