SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A7A009|A7A009_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7A009|A7A009_YEAS7
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-41
Family YKR049C-like 0.000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7A009|A7A009_YEAS7
Sequence length 133
Comment Conserved protein OS=Saccharomyces cerevisiae (strain YJM789) GN=FMP46
Sequence
MSFWKTLQRQPRTISLFTNDIASNIKSQKCLQLLKGDVSHRFDVEIANRFPTWDQLQYMR
TSCPQGPVSLQRQIPKLDSVLKYKHTDPTFGMDLQKCVQRGLWNPKEALWVDWENKLVGN
EPADIDKYIIQRK
Download sequence
Identical sequences A0A0L8VLN6 A0A250WJB8 A7A009 B3LRC8 C7GNL6 E7KF55 E7NK70 E7Q6F7 E7QHH2 G2WI77 N1P2Q0 P36141
4932.YKR049C NP_012975.3.97178 YKR049C 000011356|e1wpiA1|2485.1.1.15|A:1-133 cath|current|1wpiA00/1-133 d1wpia1 YKR049C YKR049C YKR049C YKR049C YKR049C YKR049C APC6384 YTYst250 YKR049C SCRT_04065 YKR049C YKR049C tr|A7A009|A7A009_YEAS7 YKR049C YKR049C 1wpiA YKR049C YKR049C YKR049C YKR049C YKR049C YKR049C 1wpi_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]