SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RPRC002075-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC002075-PA
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.31e-23
Family GntR-like transcriptional regulators 0.0079
Further Details:      
 
Domain Number 2 Region: 84-159
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000034
Family GntR ligand-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RPRC002075-PA
Sequence length 160
Comment pep:novel supercontig:RproC1:GL572754:388:867:1 gene:RPRC002075 transcript:RPRC002075-RA description:""
Sequence
MRLYQDIGNKIRKDILDGKYQVGDRLPSERDIAESFSVSRSVVREALIILELEKLIEVRK
GSGVYVIQIPTEDKNRNANSGYGPFELMQARQLLESEVAAFAAMQATKTDILKMKQAIDQ
ERQALDNGSVDESADELFHCLLAQSTQNSVLANMVYEVWQ
Download sequence
Identical sequences T1HDF8
RPRC002075-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]