SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RPRC014417-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC014417-PA
Domain Number 1 Region: 53-240
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.82e-24
Family RNA methyltransferase FtsJ 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RPRC014417-PA
Sequence length 242
Comment pep:novel supercontig:RproC1:GL563091:7010992:7014235:1 gene:RPRC014417 transcript:RPRC014417-RA description:""
Sequence
MAINCFQKRCISLFSFHFKESHIKLKGKSKSSQEWLLRHLKDPYVEKAKMGNFRCRSAFK
LLEIDNKYKLLHPGQCILDCGAAPGSWTQVAVSKSNSDGKGTTKPRGMVIAVDILPILPV
EGALVLGRTDLSSEEGLDRVKLALNGRLVDVLLSDMAPNATGVKEADHDSIIHLAYAVVR
FGLGVSRTGASLLLKIWDGRSSTQLTNDISRFYNKVKRVKPFASRTNSAELYVLATDFKG
LD
Download sequence
Identical sequences A0A0P4VHN9 R4FJT4
RPRC014417-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]