SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RPRC000381-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC000381-PA
Domain Number 1 Region: 166-474
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.61e-40
Family NodB-like polysaccharide deacetylase 0.0091
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000136
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 120-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RPRC000381-PA
Sequence length 540
Comment pep:novel supercontig:RproC1:GL563024:1044947:1069671:-1 gene:RPRC000381 transcript:RPRC000381-RA description:""
Sequence
MPWTSRATVLALILTIAIISGECQTLRVKRQDEPAKKEESFETELCKDKDAGEWFRLVAG
EGDNCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKDAVKNCKLKSKERKVKPLLHTDE
PLCQDGFLACGDGACVERGLFCNGEKDCTDGSDENTCDNDNDPNRAPPCDPSVCVLPDCF
CSEDGTGVPNDLPPKDIPQMITITFDDAINNNNIELYKDIFNKKRKNPNGCDIKATFFVS
HKYTNYSAVQETHRKGHEIAVHSITHNDDEQFWSNATVDDWAKEMAGMRVIVEKYANISD
NSVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQ
HCPTRSHAVWEMVMNELDRREDPNFDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYD
QNRAPLGLYFHAAWLKNNPEFLEAFLYWIDEIQEKYNDVYFVTMTQVIQWIQNPRTISEV
KNFEPWREKCSVEGPPACWVPHSCKLTSKEVPGETINLQTCVRCPNNYPWVNDPTGDGFF
Download sequence
Identical sequences R4G8G6
RPRC000381-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]