SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RPRC006115-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC006115-PA
Domain Number 1 Region: 425-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000421
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 317-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000144
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 385-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000214
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 468-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000754
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  RPRC006115-PA
Domain Number - Region: 119-143,172-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000286
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number - Region: 499-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00308
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 249-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0105
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RPRC006115-PA
Sequence length 596
Comment pep:novel supercontig:RproC1:GL563004:833276:839676:1 gene:RPRC006115 transcript:RPRC006115-RA description:""
Sequence
MDGLISDDFFTLPLVLEAPDVSQSINTINCNGWQFEVTKDQPLVILGNSDLALQNMSDPL
LLSTDTCPNRIDSPPEVEHKVEDSEIEEFVTKNKIDEEMTLSLGTNEDLMNELVETLVVY
KCKLCPFKTSEKKSLSAHLESIHLKNVKKEDVVVNVGLKLEDTSVHNSTVREEQMVYMCG
NCSEAFVTYGECRIHMALVHKIMMGNVKSEDMKAELFNTNFIKNHVKEEENSIVSNIKVV
PSKKSQVNKCHEKKLKYVCPMSGCQVKLSSREYLDKHKLCHTSDSQDFTCMECSMSFPKW
IRCAHHLWKVHNVDVDLYACSNCSYKTPYKMKLTEHCMIHSSNKNFTCNVCGKNFKQGSQ
LRNHEVSHLKGGENEDKLPNWIRRRECDQCGKTFCDSKALKKHVKAVHSKLKPYSCQVCG
HCSATKNMLRIHLRQHSGDKPFACPACSYSTGDHNSLRRHWMRHTGVRPYRCPHCPYSAI
QSCSLKSHLFRQHPGLPGVYSCNQCTFVSVSETALQHHIRTHTTKMRKNEDNCSERSLHN
SNGIHYNGGGNINGSAAADEDDESNHFFDSEPIVTDTGGITIPADQPCLATSELNI
Download sequence
Identical sequences R4G3I5
RPRC006115-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]