SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RPRC006217-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC006217-PA
Domain Number 1 Region: 2-281
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.81e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000000174
Further Details:      
 
Domain Number 2 Region: 404-490
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.93e-26
Family Ricin B-like 0.0002
Further Details:      
 
Domain Number 3 Region: 289-401
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000562
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RPRC006217-PA
Sequence length 496
Comment pep:novel supercontig:RproC1:GL556903:2404:16684:-1 gene:RPRC006217 transcript:RPRC006217-RA description:""
Sequence
RCKEKTYPRLLPTTSIVIVFHNEAWSTLLRTVWSVINRSPRPLLKEIILVDDASEREHLG
KQLEDYVATLPVPVHVLRTEERSGLIRARLLGAKHVKGQVITFLDAHCECAEGWLEPLLA
RIVQNRKTVVCPIIDVLSDETFEYITASDMTWGGFNWKLNFRWYRVPQREMERRGGDRTA
PLRTPTMAGGLFSIDREYFYELGAYDEGMDIWGGENLEMSFRVWQCGGILEIIPCSHVGH
VFRDKSPYTFPGGVSKIVLHNAARVAEVWMDEWRDFYYAMNPGTPHPLRAAGFFQPDSFY
NLYNIYIWMCGGILEIATCSHVGHVFRKSTPYTFPGGTSRIVNHNNARLAEVWLDEWRQF
YYSINPGAHNVAVGDVSGRKALREKLKCKSFRWYLENIYPESQMPLDYYYLGEVRNVESQ
NCLDTLGRKNNDILGMSYCHGLGGNQVFAYTKRQQIMSDDNCLDAASMDGPVKLVRCHGM
GGNQAWVYNREVSTFQ
Download sequence
Identical sequences T1HQ93
RPRC006217-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]