SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RPRC008796-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC008796-PA
Domain Number 1 Region: 161-467
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.45e-31
Family NodB-like polysaccharide deacetylase 0.028
Further Details:      
 
Domain Number 2 Region: 113-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 37-100
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000152
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RPRC008796-PA
Sequence length 533
Comment pep:novel supercontig:RproC1:GL563024:967052:978221:-1 gene:RPRC008796 transcript:RPRC008796-RA description:""
Sequence
MTQMFRVLEIKLCFIECNIRHKRQDDDEEEEDGQSVEELCKDRPPDEYFRLTTTGDCRDV
VRCTKAGMKQISCPSGLAFDIDKQTCDWRGKVSNCDRLDKPRKVMPILKTDEPVCPEGKL
SCGNGECIEKELFCNDKPDCKDESDENACTVELDPNRAPDCDSNQCVLPDCFCSADGTRI
PGGIEPNQVPQMITITFNGAVNVDNIDLYDEIFNGQRQNPNGCQIRGTFFVSHKYTNYAA
VQDLHRRGHEISVFSLTHKDDPKYWTGGSYDDWLAEMAGSRLIVERFANITDGSIIGVRA
PYLRVGGNKQFEMMADQYFVYDASITAPLGRIPIWPYTLYFRMPHKCNGNAQNCPSRSHP
IWEMVMNELDRRDDPTFDESLPGCHMVDSCSNIQTGEQFARLLRHNFNRHFSTNRAPLGL
HFHASWLKSKKEFKEELIKFITEMLDRNDVYFVTMLQVIQWMQNPTELTALRDFQEWKEK
CDVKGQPYCSLPNPCPLTTRELPGQTVRLFTCMECPNNYPWILDPTGDGFSSK
Download sequence
Identical sequences T1HXM6
RPRC008796-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]