SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RPRC013523-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC013523-PA
Domain Number 1 Region: 2-283
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.94e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000000162
Further Details:      
 
Domain Number 2 Region: 405-491
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.93e-26
Family Ricin B-like 0.0002
Further Details:      
 
Domain Number 3 Region: 289-402
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000562
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RPRC013523-PA
Sequence length 497
Comment pep:novel supercontig:RproC1:GL546754:5581:19845:1 gene:RPRC013523 transcript:RPRC013523-RA description:""
Sequence
YRCKEKTYPRLLPTTSIVIVFHNEAWSTLLRTVWSVINRSPRPLLKEIILVDDASEREHL
GKQLEDYVATLPVPVHVLRTEERSGLIRARLLGAKHVKGQVITFLDAHCECAEGWLEPLL
ARIVQNRKTVVCPIIDVLSDETFEYITASDMTWGGFNWKLNFRWYRVPQREMERRGGDRT
APLRTPTMAGGLFSIDREYFYELGAYDEGMDIWGGENLEMSFRVWQCGGILEIIPCSHVG
HVFRDKSPYTFPGGVSKIVLHNAARVAEVWMDEWRDFYYAMNPGTPHPLRAAGFFQPDSF
YNLYNIYIWMCGGILEIATCSHVGHVFRKSTPYTFPGGTSRIVNHNNARLAEVWLDEWRQ
FYYSINPGAHNVAVGDVSGRKALREKLKCKSFRWYLENIYPESQMPLDYYYLGEVRNVES
QNCLDTLGRKNNDILGMSYCHGLGGNQVFAYTKRQQIMSDDNCLDAASMDGPVKLVRCHG
MGGNQAWVYNREVSTFQ
Download sequence
Identical sequences RPRC013523-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]