SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|YALI0C11803g from Yarrowia lipolytica CLIB122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|YALI0C11803g
Domain Number 1 Region: 3-286
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.88e-93
Family Inorganic pyrophosphatase 0.0000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|YALI0C11803g
Sequence length 291
Comment similar to uniprot|P00817 Saccharomyces cerevisiae YBR011c Inorganic pyrophosphatase [Yarrowia lipolytica] Complete CDS. YALI0C11803g
Sequence
MSYKTRTNGQLYTKDFKLYIENEAGDPISAFHDIPVYPDSGKIRFEQPKSDLVNMVVEVP
RWSNAKMEISKSAELNPITQDVKKDRVRFVRNFYPHHGYCHNYGAIPQTWENPHVKDSLT
QIEGDNDPIDVVDIGQALGKMGQVKTVKVVGALGLIDEGETDWKIIAIDVRDPRAAKIND
ISDVSKSVLNDIYDWFKYYKVPDGKPANNFAFDGKFLNKAEALDVVYEGHVHWLELLKGN
VPAGEIDLTNVTLTDTKGFKSRHDVAIKANEVVEPAKVSSSVNDWLVVERE
Download sequence
Identical sequences Q6CC75
gnl|GLV|YALI0C11803g XP_501737.1.88470 4952.Q6CC75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]