SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|YALI0B21662g from Yarrowia lipolytica CLIB122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|YALI0B21662g
Domain Number 1 Region: 723-796
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 2 Region: 179-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 3 Region: 798-882
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 4 Region: 954-1055
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 1155-1214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 873-961
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0052
Further Details:      
 
Domain Number 7 Region: 634-724
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 8 Region: 428-503
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000843
Family Eukaryotic type KH-domain (KH-domain type I) 0.0078
Further Details:      
 
Weak hits

Sequence:  gnl|GLV|YALI0B21662g
Domain Number - Region: 351-401
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0089
Further Details:      
 
Domain Number - Region: 569-652
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0062
Further Details:      
 
Domain Number - Region: 487-536
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0922
Family Eukaryotic type KH-domain (KH-domain type I) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|YALI0B21662g
Sequence length 1215
Comment weakly similar to uniprot|P06105 Saccharomyces cerevisiae YJL080c SCP160 required for maintenance of exact ploidy [Yarrowia lipolytica] Complete CDS. YALI0B21662g
Sequence
MSDLSPAELLRQRHAAVSAAAEPTLTVSEGSLSKESSPVPEIAPAAPVKSVAGPSAASKR
KGLDINSLEAFPALNGGAAAPKAVWGKGGSAPAAPSPQSFGRAASTTISDVFTLKREEQQ
VGVRSELPKIIAKVKANTSTTIDSSTSKITGHTSFVIKGTPENVAKARRELHRALSQKIV
AKFEIPASVRAAVIGPRGSNLKPILEKSGAHIQIEKLESNGNNADDDEETVEVIVEGDSE
GIAIAKQEIFAIVSERVKNMTIRVRNVNYVLFPFLDKTAGDLTKGEDDVKLSIPDIFAPN
FTTAATITLSGDREATATVKERLERLAESLSTDLITSTESFPASKHKYISAKDVFAATSV
FITVPQAPNTSDDTVKFLGLPKDIKPAMNKVSEQVNSVKIDLLDISRAHGKSVPHAQALA
SYFKASGMLQKIADEYKVEIYIQQPDQLYAPGAQAVTIETSGPNEEAVKAARKAIVALVN
KYEPSKVSRVSDIDPFFLRNLAGPKDRNLAKYKKDHGVTVLVPENPKVNGDVILIYEGTS
EEDDFGPSADEIKATFAAVDSSFADIREKQAKIIGKLISVPVGEHKFVRGPDNTTLRAIV
GGTEGHEPFVRVTFGDEIKDAEEPVSADSIYVRGLKDEVTRVLKEIEEAVEDGKNYAVLS
QYTTEFQIPPEHVKHVVGKGGSQLAKFREYGVNIDLDESGQGVVKGIKKNADEAKVQILA
FAKKIADEVNVKLPVPADHHASLIGTGGKFVKRLEEKYDVRIRFPKTGEENANEIVLRGP
SKGVAKAKEEILDLVNYEIENSHSQTISVPVKSLPRIIGRGGEFINDIKDSTNTRIDVKQ
EKSDNTDETGNVDIEIVGTKAGVKEAAAKIQAIVSEFQDTVIEHIEVNPKFHGALIGPGG
QTLKDILTKAGMTDVTPSVAARTVAVPAAGTKDNKVRVQGSKKIVAKIVKIIQDMVAERE
SQISEVVDVPVSKHRDLIGAGGAAKRSLEEKFKVTLQIPKQGAKNKDGELDTGVSITGKA
EDVATAKAKIQELSQDKWKEEILVPRTLHTTVSDNGNLPRKLKYELKVNVDHGSVRTPRD
GNPVVPAGAIGSDSEDKDSFRWSVVEDAVDHAANGTIPWRLEGSDENVAKAKAIIEAALD
VALKHTQTGYLWLPDTSRYRFLVGPHGATVSHIREKSGCKIYIPKAGVADSAVTVRGSPE
GLEKAKEMMLAALKK
Download sequence
Identical sequences Q6CDS1
gnl|GLV|YALI0B21662g XP_501191.1.88470 4952.Q6CDS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]