SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|YALI0D23463g from Yarrowia lipolytica CLIB122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|YALI0D23463g
Domain Number 1 Region: 787-982
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-66
Family Sec7 domain 0.00000333
Further Details:      
 
Domain Number 2 Region: 1109-1143,1199-1215,1302-1608
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000176
Family Armadillo repeat 0.059
Further Details:      
 
Weak hits

Sequence:  gnl|GLV|YALI0D23463g
Domain Number - Region: 257-344,554-644
Classification Level Classification E-value
Superfamily ARM repeat 0.0194
Family MIF4G domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|YALI0D23463g
Sequence length 1861
Comment similar to uniprot|Q96X17 Pichia pastoris Sec7p [Yarrowia lipolytica] Complete CDS. YALI0D23463g
Sequence
MGKKNKAKSADKAADKEPDVPMSVSTEAPAAPDTTTDTSTPTTTNGIEAEEHLKVTEDSN
EEGKAEALPGDLTTQAEEPPVAATEKAVEKVKEEEAKVEKDESNPETEVETESKLEAETE
SKPEAETESKPEAESKPATSSDATSSAPIDEPTTGDMSAETVEPTKLAEKTNGNAAPAIS
VTEAEKTEESNKAAAPAPASSGTSANASVSVRPSRAHSTAGSISSVNSTRSSMASSVFIK
NSLNTISTSKEAKKNAALSTAVGKALSSLDRDENPSAQTIFEPMRLVCQGNDAEMQVVAL
DAIGKMFTYSFFEDPAPLPHNEEAGIVPPPRIPLIEQAITCVCEAHRGDATDQRVELQIV
KALMAAVLNEEHIAHGATLLKAIRQSYNIFVTSPYQANQIVAQASISQMVNVVFERVKVN
LKKKAIAADNNLDYVESTADILASSNGSSSDIKLNLSDLNRADVDDEDRVMEAKTSAGQD
KSDIVAKDAFLVFRAMSKLSIKDIESDSVDIRSKEMRSKLLSLHLVHSILKSHMTVFLSK
DVVIKSSGAAKNTTFVNAVRQYICLTLAKNASSITPAVFELSAEIFWLLLSNLRGQFKKE
IDVVLTEVYFHIVEMKTSTAHQKLYFLGIISRLCNDPRALVEVFLNYDCTRGVGNIYETL
INYLVRHATARIIMTPVQMQQYREWKHKPIAVYNTSLPPQLASANLTSTSYTPEVLPYPV
EYALRMTSLECIVAVLRSLHSWSHKGMTAAGGATISIAASDSTTPTGRHSSVSSLSSIQQ
NDFVDDPSQFEDLKLQKSNLEGGIRMFNQSPKRGMAALIKSGFVASSAPEDIAKFLIETD
GLDKAKIGDYLGGHEKENVEIMYAFVDHHDFTGMRYVDALRIFLQSFRLPGEAQKIDRFL
LKFAQRYISGNPDSAFVNAESAYVLAYSVVMLNVDQHSTKVKNRMKPENFVSNNRGINEG
GDLPPELLLEIFEEIQKNEIKLDSEQADAAISNAFEAAEQPTGIAATLGFGKDVNKEAYL
KAAKEMTSKTEQLFRGSSSTNDEPGLYYVASHFEHVRPMFDSVWMSVVAALSGPLHTSDD
EETVKLCLDGIKYSIKISCLFDIELPRESFVNTLAKFTSLSQLHEMRQKNIEAIKVLLEV
AVSDGAGLKRGWKDILTCVSQLERCQLIVGGVSATAIPDINDARIHGRASLDRRRTLPPN
MANTFTPEVEAALKSESLNKLTDKIFVQSASLPVDSCVDFVRALAEVSWQEIKSSAGNEN
PRTFSLQKMVDVSYYNMGRIKMEWTPIWAVMGAQFNKVGTIPNTMIVFMALDSLRQLAGR
FLDLEELSHFKFQKDFLQPFEYIMEKNSSGEVKDMVLQCIRQLLLSKKSAFRSGWISVFN
VCGAATSSSSKSLLNTAFDIVKKAREQLLTEVILQDAFVPMTKCLTAIAMNQLSQKTALH
AIEQLKAIIVDVSNDKTEDNGVPHPQQLPRLWMPVFQSFHDIIMTGEDLEVRSRALNYLF
DVLVQYGGGFEADSWDTICTEVLFPIFVILKSRSEMARFNNQDDVSVWLSTTMIQALRNM
IALFTHYFSTLDRMLDGFLDLLVTCINQENDTVSRIGSTCLQQLITENVNNFNDAHWAKI
VDTFGELFKTNTAVELFESTRKPDDPEDKPQRTDKQKIFKTIIVKCILQLLAIDTVEGLF
QDQQVYQCIPTKQLLRITDMLQESYTFSKTFNADKDLRMRLWKEGFMKQYPNLFRQESHS
VSTYLHLTFKVYLDPVKTTTEQHDAIGKQLLPLALELMEMYAALDFDQNKEKVISTWTPV
IVSVLQNYARFPDSEFNANAEDFFKLSLNLLEKDVSLEVRVAVKHILHRVGQLYMKGKGK
E
Download sequence
Identical sequences A0A1D8NFW4 Q6C820
XP_503192.1.88470 gnl|GLV|YALI0D23463g 4952.Q6C820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]