SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Mycfi1|64442|fgenesh1_pm.C_scaffold_11000039 from Mycosphaerella fijiensis CIRAD86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycfi1|64442|fgenesh1_pm.C_scaffold_11000039
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.01e-40
Family Deoxycytidylate deaminase-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycfi1|64442|fgenesh1_pm.C_scaffold_11000039
Sequence length 151
Sequence
MSTDDAGFTAALEEAQQGFEEGGVPIGACLVAADGTILGRGHNMRVQENSAILHGETSAL
ENAGRLPASAYKGSTMYTTLSPCNMCTGACILYKVSRVVMGENNTFVGGEELLRQHGIEV
VNLQNAECEQLMKDFIAKHPEDWYEDIGEDV
Download sequence
Identical sequences M2YPC3
jgi|Mycfi1|64442|fgenesh1_pm.C_scaffold_11000039 XP_007929791.1.3604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]