SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479144159|ref|YP_007775022.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479144159|ref|YP_007775022.1|
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.62e-36
Family N-utilization substance G protein NusG, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 104-171
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.02e-16
Family N-utilization substance G protein NusG, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479144159|ref|YP_007775022.1|
Sequence length 173
Comment transcription antitermination protein nusG [Eubacterium siraeum 70/3]
Sequence
MSEAKWYILHTYSGYENKVAGNIMKVVENNNLHHLIEEVMVPTETVVEEHDGKTKTYESK
LFPSYVYVKMILTDESWYICRNTRGCTGFVGPGSKPIPLTDEEVKNLGVTTKVAEISFAV
GDTIKIVSGSLEGFEGTVDSIDEENGTAQVTVSMFGRPTPATVEISAVQKVEI
Download sequence
Identical sequences A0A174ZZ24 A0A1Q6NQ52 B0MM79 D4JSQ1 D4MMK9 R6RJ36
WP_005355337.1.40803 WP_005355337.1.81606 WP_005355337.1.86524 gi|479212739|ref|YP_007840521.1| gi|479144159|ref|YP_007775022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]