SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479145742|ref|YP_007776605.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479145742|ref|YP_007776605.1|
Domain Number 1 Region: 51-173
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.06e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000369
Further Details:      
 
Domain Number 2 Region: 9-51,174-228
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 7.65e-33
Family RNA polymerase alpha subunit dimerisation domain 0.0011
Further Details:      
 
Domain Number 3 Region: 249-317
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 3.4e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0000992
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479145742|ref|YP_007776605.1|
Sequence length 319
Comment DNA-directed RNA polymerase subunit alpha [Eubacterium siraeum 70/3]
Sequence
MLEKIEKPVIETVKLKPDGTYGMFTLEPLECGYGNTLGNSLRRVLLSSLPGVAVTSVKID
GVQHEFSTIPGVKEDVTEIILNIKGLIAKMYGECPKTVYIEAEGECDVTAGDIKTDSEIE
ILDPGMHIATLGPGAKLYMEITLDKGRGYVSAEKNKQQLQPVIGIIAVDSIYTPVLKVNY
TVENTRVGQRTDYDKLILEVWTDGTISAKEAVSYAAKLLVDHLQPFVELSDEAIQPELMA
DKSESGKDKLLEMTIDDLDLSVRSFNCLKRANINTVDDLINKSQGDMMKVRNLGKKSFEE
VRAKLQSLGFDLASDDDNN
Download sequence
Identical sequences A0A174Z4P1 A0A1Q6S656 D4JX84 D4MNC6 R6R5Y1
WP_015519841.1.81606 gi|479213006|ref|YP_007840788.1| gi|479145742|ref|YP_007776605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]