SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|564912614|ref|YP_008879306.1| from Pandoraea sp. RB-44

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564912614|ref|YP_008879306.1|
Domain Number 1 Region: 60-201
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.38e-16
Family GntR ligand-binding domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000124
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564912614|ref|YP_008879306.1|
Sequence length 246
Comment GntR family transcriptional regulator [Pandoraea sp. RB-44]
Sequence
MHRDILAGVLAPNEKLRLQGLQARYGLGMSPIREALMLLSREGLVSNEGQRGFRVTPVSV
EDLQDIVWARLNIETILLGQSIRHGDADWGAEISAAFYKLTHAPVPASLDDIETLEAWEA
AHRRFHRALLAGAKSPWLHRVDAQLVDLTERYRRIRLARMGFTARTDSIFTEHKALMEAA
LARDVDTACHLLHEHLTATFDAQKWLDDGLAATDDVPAAAPAPAKRPAGKAVSPRARRSA
DTLEKA
Download sequence
Identical sequences V5UE32
gi|564912614|ref|YP_008879306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]