SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108809203|ref|YP_653119.1| from Yersinia pestis Antiqua

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108809203|ref|YP_653119.1|
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.66e-22
Family GntR-like transcriptional regulators 0.015
Further Details:      
 
Domain Number 2 Region: 93-226
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.05e-19
Family GntR ligand-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108809203|ref|YP_653119.1|
Sequence length 264
Comment DNA-binding transcriptional repressor ExuR [Yersinia pestis Antiqua]
Sequence
MEFTETRRLYQQLAAELKRRIEAGVYPVGDKLPAERYISEEMNVSRTVVREAIIMLEVEG
YVEVRKGSGIHVMSNQQKHLVTNQGIEFDTAGPFELLQARQLIESNIAEFAATQVTRQDI
VQLIEIQKHARQEDRFRDSQWDLKFHVQVALATQNTAMATIVEKMWSQRTHNPYWIKLHE
HIDDVSIESWCEDHDKILEALIRKDPHASKLAMWQHLENTKQMLFRATTDDFEFNVDRYL
FTENPVVHLDNLMNNSKVPISSKN
Download sequence
Identical sequences A0A0E1NQ10 A0A0H2YDW1 A0A0H3AZA0 A0A0M1V7Y8 A0A0U1EUC2 A0A0U1R397 A0A208RQY9 A0A2A7VJF5 Q0WJ90 Q665N6
gi|218927773|ref|YP_002345648.1| gi|108809203|ref|YP_653119.1| gi|161511341|ref|NP_994201.2| gi|186896963|ref|YP_001874075.1| WP_002210412.1.100083 WP_002210412.1.100246 WP_002210412.1.100593 WP_002210412.1.10066 WP_002210412.1.100921 WP_002210412.1.100931 WP_002210412.1.10105 WP_002210412.1.101305 WP_002210412.1.101382 WP_002210412.1.101928 WP_002210412.1.102012 WP_002210412.1.102067 WP_002210412.1.10736 WP_002210412.1.10935 WP_002210412.1.10955 WP_002210412.1.11693 WP_002210412.1.12167 WP_002210412.1.12463 WP_002210412.1.12736 WP_002210412.1.12857 WP_002210412.1.1388 WP_002210412.1.14063 WP_002210412.1.14169 WP_002210412.1.14804 WP_002210412.1.15321 WP_002210412.1.15555 WP_002210412.1.15605 WP_002210412.1.15689 WP_002210412.1.16243 WP_002210412.1.16333 WP_002210412.1.17135 WP_002210412.1.17141 WP_002210412.1.17608 WP_002210412.1.17873 WP_002210412.1.17983 WP_002210412.1.18208 WP_002210412.1.18640 WP_002210412.1.18826 WP_002210412.1.19329 WP_002210412.1.19425 WP_002210412.1.19739 WP_002210412.1.19763 WP_002210412.1.20035 WP_002210412.1.20380 WP_002210412.1.20547 WP_002210412.1.2064 WP_002210412.1.20932 WP_002210412.1.21486 WP_002210412.1.21784 WP_002210412.1.21879 WP_002210412.1.21934 WP_002210412.1.22530 WP_002210412.1.22542 WP_002210412.1.22708 WP_002210412.1.23157 WP_002210412.1.23271 WP_002210412.1.23687 WP_002210412.1.23811 WP_002210412.1.24002 WP_002210412.1.2451 WP_002210412.1.24517 WP_002210412.1.25181 WP_002210412.1.25394 WP_002210412.1.26383 WP_002210412.1.2640 WP_002210412.1.26776 WP_002210412.1.26960 WP_002210412.1.27124 WP_002210412.1.27251 WP_002210412.1.2726 WP_002210412.1.28647 WP_002210412.1.28922 WP_002210412.1.29157 WP_002210412.1.29186 WP_002210412.1.29355 WP_002210412.1.2947 WP_002210412.1.29622 WP_002210412.1.2964 WP_002210412.1.29685 WP_002210412.1.29814 WP_002210412.1.3092 WP_002210412.1.30931 WP_002210412.1.311 WP_002210412.1.31336 WP_002210412.1.31496 WP_002210412.1.31721 WP_002210412.1.31739 WP_002210412.1.31805 WP_002210412.1.32343 WP_002210412.1.32388 WP_002210412.1.32446 WP_002210412.1.32736 WP_002210412.1.33203 WP_002210412.1.33324 WP_002210412.1.33661 WP_002210412.1.33775 WP_002210412.1.33937 WP_002210412.1.34031 WP_002210412.1.34138 WP_002210412.1.35389 WP_002210412.1.35538 WP_002210412.1.36088 WP_002210412.1.37174 WP_002210412.1.37494 WP_002210412.1.37863 WP_002210412.1.38147 WP_002210412.1.38235 WP_002210412.1.38532 WP_002210412.1.38743 WP_002210412.1.38824 WP_002210412.1.38993 WP_002210412.1.39066 WP_002210412.1.39346 WP_002210412.1.3976 WP_002210412.1.39858 WP_002210412.1.40071 WP_002210412.1.40134 WP_002210412.1.40534 WP_002210412.1.40853 WP_002210412.1.41196 WP_002210412.1.41984 WP_002210412.1.4210 WP_002210412.1.42361 WP_002210412.1.42490 WP_002210412.1.42976 WP_002210412.1.44408 WP_002210412.1.44598 WP_002210412.1.44603 WP_002210412.1.44832 WP_002210412.1.45198 WP_002210412.1.45214 WP_002210412.1.46262 WP_002210412.1.46545 WP_002210412.1.46686 WP_002210412.1.46697 WP_002210412.1.46731 WP_002210412.1.4678 WP_002210412.1.46891 WP_002210412.1.47387 WP_002210412.1.47440 WP_002210412.1.47769 WP_002210412.1.48166 WP_002210412.1.48722 WP_002210412.1.4889 WP_002210412.1.49315 WP_002210412.1.49906 WP_002210412.1.4997 WP_002210412.1.50010 WP_002210412.1.50093 WP_002210412.1.50106 WP_002210412.1.50185 WP_002210412.1.50984 WP_002210412.1.51284 WP_002210412.1.51293 WP_002210412.1.51588 WP_002210412.1.51772 WP_002210412.1.51934 WP_002210412.1.52158 WP_002210412.1.52247 WP_002210412.1.52473 WP_002210412.1.52734 WP_002210412.1.52792 WP_002210412.1.52819 WP_002210412.1.52969 WP_002210412.1.53147 WP_002210412.1.53300 WP_002210412.1.53838 WP_002210412.1.53883 WP_002210412.1.53953 WP_002210412.1.54568 WP_002210412.1.54951 WP_002210412.1.55194 WP_002210412.1.55695 WP_002210412.1.5592 WP_002210412.1.56031 WP_002210412.1.56912 WP_002210412.1.56953 WP_002210412.1.57585 WP_002210412.1.57657 WP_002210412.1.58067 WP_002210412.1.58543 WP_002210412.1.59102 WP_002210412.1.59431 WP_002210412.1.5957 WP_002210412.1.59635 WP_002210412.1.5968 WP_002210412.1.59687 WP_002210412.1.59789 WP_002210412.1.59885 WP_002210412.1.60437 WP_002210412.1.60707 WP_002210412.1.60896 WP_002210412.1.61689 WP_002210412.1.62232 WP_002210412.1.62342 WP_002210412.1.6270 WP_002210412.1.6333 WP_002210412.1.63387 WP_002210412.1.63641 WP_002210412.1.64142 WP_002210412.1.64474 WP_002210412.1.64780 WP_002210412.1.64786 WP_002210412.1.64910 WP_002210412.1.653 WP_002210412.1.65400 WP_002210412.1.65554 WP_002210412.1.6570 WP_002210412.1.65706 WP_002210412.1.65718 WP_002210412.1.6581 WP_002210412.1.66118 WP_002210412.1.66546 WP_002210412.1.66616 WP_002210412.1.67850 WP_002210412.1.6791 WP_002210412.1.68361 WP_002210412.1.68371 WP_002210412.1.68753 WP_002210412.1.68855 WP_002210412.1.69018 WP_002210412.1.69316 WP_002210412.1.69951 WP_002210412.1.70117 WP_002210412.1.70171 WP_002210412.1.70319 WP_002210412.1.70377 WP_002210412.1.70417 WP_002210412.1.70726 WP_002210412.1.7083 WP_002210412.1.7169 WP_002210412.1.71744 WP_002210412.1.72280 WP_002210412.1.72440 WP_002210412.1.72486 WP_002210412.1.7402 WP_002210412.1.74131 WP_002210412.1.74310 WP_002210412.1.74577 WP_002210412.1.74738 WP_002210412.1.75169 WP_002210412.1.75173 WP_002210412.1.7518 WP_002210412.1.75208 WP_002210412.1.75337 WP_002210412.1.75407 WP_002210412.1.75636 WP_002210412.1.75821 WP_002210412.1.76555 WP_002210412.1.76670 WP_002210412.1.77295 WP_002210412.1.77387 WP_002210412.1.77429 WP_002210412.1.77569 WP_002210412.1.77691 WP_002210412.1.78004 WP_002210412.1.7841 WP_002210412.1.78556 WP_002210412.1.79515 WP_002210412.1.79550 WP_002210412.1.79609 WP_002210412.1.79825 WP_002210412.1.79981 WP_002210412.1.8009 WP_002210412.1.80331 WP_002210412.1.81848 WP_002210412.1.81877 WP_002210412.1.8210 WP_002210412.1.82133 WP_002210412.1.82151 WP_002210412.1.82270 WP_002210412.1.82436 WP_002210412.1.82619 WP_002210412.1.8303 WP_002210412.1.83039 WP_002210412.1.83265 WP_002210412.1.83630 WP_002210412.1.8420 WP_002210412.1.84703 WP_002210412.1.84720 WP_002210412.1.85269 WP_002210412.1.85270 WP_002210412.1.8559 WP_002210412.1.85802 WP_002210412.1.86034 WP_002210412.1.86413 WP_002210412.1.87107 WP_002210412.1.8728 WP_002210412.1.87418 WP_002210412.1.8762 WP_002210412.1.87853 WP_002210412.1.87988 WP_002210412.1.88362 WP_002210412.1.88472 WP_002210412.1.89359 WP_002210412.1.89542 WP_002210412.1.8964 WP_002210412.1.90176 WP_002210412.1.9051 WP_002210412.1.90624 WP_002210412.1.91263 WP_002210412.1.91373 WP_002210412.1.91844 WP_002210412.1.92030 WP_002210412.1.92331 WP_002210412.1.92604 WP_002210412.1.927 WP_002210412.1.9311 WP_002210412.1.9320 WP_002210412.1.93623 WP_002210412.1.93928 WP_002210412.1.93933 WP_002210412.1.94052 WP_002210412.1.94201 WP_002210412.1.94545 WP_002210412.1.94683 WP_002210412.1.95746 WP_002210412.1.95981 WP_002210412.1.97245 WP_002210412.1.97448 WP_002210412.1.97791 WP_002210412.1.97864 WP_002210412.1.97872 WP_002210412.1.97894 WP_002210412.1.99109 WP_002210412.1.99383 WP_002210412.1.9941 WP_002210412.1.99416 WP_002210412.1.99788 WP_002210412.1.99882 WP_002210412.1.99972 WP_002210412.1.99990 YP_002345648.1.25044 gi|170022803|ref|YP_001719308.1| gi|108810610|ref|YP_646377.1| gi|384121097|ref|YP_005503717.1| gi|384137434|ref|YP_005520136.1| 187410.y3602 214092.YPO0576 229193.YP_2896 273123.YPTB3480 349746.YpAngola_A1106 349747.YpsIP31758_0489 360102.YPA_3212 377628.YPN_0445 386656.YPDSF_0363 502800.YPK_0552 502801.YPTS_3665 gi|161484750|ref|NP_670899.2| gi|162418411|ref|YP_001605652.1| gi|145597677|ref|YP_001161753.1| gi|153950841|ref|YP_001399482.1| gi|384416441|ref|YP_005625803.1| gi|384124976|ref|YP_005507590.1| gi|294502663|ref|YP_003566725.1| gi|51597772|ref|YP_071963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]