SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85858350|ref|YP_460552.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858350|ref|YP_460552.1|
Domain Number 1 Region: 31-230
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.36e-43
Family Nuclease 0.029
Further Details:      
 
Domain Number 2 Region: 242-377
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.08e-28
Family Nuclease 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85858350|ref|YP_460552.1|
Sequence length 492
Comment cardiolipin synthetase [Syntrophus aciditrophicus SB]
Sequence
MRGTIQVDNREQDILAEMRVLANQAFSRAAGAPLVEGNHVRLLKDASENYPAWLNAIGGA
KHHIHIENYIIREDDTGHLFADALIAKAKEGVRVRLIYDWMGGFGKTSQRFWDRLYLGGV
EVRCYNPPRLDSPLGWLSRDHRKMLAIDGKIGFITGLCIGQMWEGIPEKGIEPWRDTGVE
VRGIAVADVEQAFAQVWALMGEPIPEHEIVKREALCRAGDMSMRVVASMPTTAGMFRLDQ
LIVALARKRLWLTDAYYAGTSAYVQALRAASKDGVDVRLLVPNGTDIPILRLLARAGYRP
LLEAGVRIFEWNGTMLHAKTAIADEGWARVGSTNLNVASWFGNCELDAVVEDESFVQEME
EMYLQDLTNATEIVLDAKLKVCAPGEPHLTHKAMKRGGGSVGRAAAGTIRVSNVIGAAFT
DRRVLEPFEARLMTVVGTCLLVLASLFAYFPRGLAYPVLIIFVWFGVALLYRSYKLHLKG
KQTKASDTSRKL
Download sequence
Identical sequences Q2LPI0
gi|85858350|ref|YP_460552.1| WP_011416418.1.90099 56780.SYN_02342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]