SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85858746|ref|YP_460948.1| from Syntrophus aciditrophicus SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85858746|ref|YP_460948.1|
Domain Number 1 Region: 272-438,590-684,747-827
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-20
Family ABC transporter ATPase domain-like 0.029
Further Details:      
 
Domain Number 2 Region: 39-148
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000129
Family PHP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85858746|ref|YP_460948.1|
Sequence length 881
Comment DNA repair ATPase [Syntrophus aciditrophicus SB]
Sequence
MSKARYARFWKCALQVNPWDYARKYRGRDHGLDESEYNNQILQTCQSEDIHVVGIADHGS
VDTLDGLRQVLVNGGIVVFPGFEIASAEKAHFVCLFSENTTIQQLERYLGSLKLTDPDDG
VHPSSLSAEQLLWEIEQLGGIAYAAHCTEKSGVLQRKLDHVWKNSLLLAAQVPGSLDDLK
NDEGNAYRIILRNKNRDYQRERPIGIINAKDVAEPKDLQLPQACCLVRMTEPCFDAFRQA
FLDPESRVRLLSDRQERFFSQLERVRFTGGYLPGVDIQLSGHLNAIIGGRGTGKTTLLEC
IRYAMEQEPISERAKRTHREIVKQNLGAGRVEIDIRSFTMQGRRFTISRRYGEAAIVRDE
SGNTSTFRPADLLPRLEIFGQNEIFDIAQDEGGLTSLLRRFLSSKDATDRRRIEIQDKLR
GNAKRLVDARSKLAEIEDQVARLPKLEEQARQFQTIGLGEKLAIVPKLEKERQLAARIEE
EQRNVQEALVSLEDALPDATFLGEEVVKGLPHVQEIRKLRSNLTTLHSELETLIANAKQK
VEVSDTEIKAKITALSAKITGEEATLEQEFAKIPAFQGRTGREIGSAYQQVLKDIERIRP
LKTKRDTRQMLVTELRKERNNLLANLSEAIANAAAEIDVELKILRKKLEGKLRPSVDHAA
NRRELKDFIMKCNLEGVGEARLRWLDDAEEFSPIRLAQTIRQGAEALKNAGWGMTAGVAE
ALTKLSESKLLEIEAMVLPDIIRLELNVAHIGKEEYRPISKLSTGQQCTAVLHLLLLENR
DPLIVDQPEDNLDNAFIAERIVTELRSAKLGRQFIFATHNANIPVFGDAEWIGVLQASEG
QANMPDEFQGAVDVPEIRSQAAAILEGGKEAFIQRKEKYGF
Download sequence
Identical sequences Q2LRR6
gi|85858746|ref|YP_460948.1| 56780.SYN_02754 WP_011416813.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]