SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|101938|estExt_fgenesh1_kg.C_150108 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|PhycaF7|101938|estExt_fgenesh1_kg.C_150108
Domain Number - Region: 82-190
Classification Level Classification E-value
Superfamily PhoU-like 0.0131
Family PhoU-like 0.024
Further Details:      
 
Domain Number - Region: 157-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0595
Family HkH motif-containing C2H2 finger 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|101938|estExt_fgenesh1_kg.C_150108
Sequence length 293
Sequence
MGLNRDGDRPDEATMDFRHAKACKFYLCGLCPHDLFQNTRLDIGACKLLHRPSLRSAYEE
QRLKQDFGYEQVLVRELSKLLADVEKKIARAQRRLVEDEEDLEGRTQILQLTQDMQDTAL
QAEKAAKDGDADKSLQMMEKVELLKRKRRELLRQSNTGANVQDVNQKLRVCDVCGAFLSI
FDSEQRLADHFGGKVHVGYVKIREKLKQLMEKTKEAQVEIRRSASCSRKRQDRPRREEDR
ENRRFRSRSRERRRSRERSSRKHHRRPMNSNRSRSRSRSRSQEHKRRSRRRYH
Download sequence
Identical sequences jgi|PhycaF7|101938|estExt_fgenesh1_kg.C_150108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]