SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|113160|estExt_fgenesh1_pg.C_270079 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|113160|estExt_fgenesh1_pg.C_270079
Domain Number 1 Region: 51-252
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.39e-71
Family Phosphate binding protein-like 0.000000469
Further Details:      
 
Domain Number 2 Region: 884-1099
Classification Level Classification E-value
Superfamily PhoU-like 2.62e-63
Family PhoU-like 0.0000199
Further Details:      
 
Domain Number 3 Region: 695-852
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-29
Family ABC transporter ATPase domain-like 0.0014
Further Details:      
 
Domain Number 4 Region: 450-683
Classification Level Classification E-value
Superfamily MetI-like 2.75e-27
Family MetI-like 0.0035
Further Details:      
 
Domain Number 5 Region: 230-457
Classification Level Classification E-value
Superfamily MetI-like 1.96e-26
Family MetI-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|113160|estExt_fgenesh1_pg.C_270079
Sequence length 1109
Sequence
MKLHSAGLAALSLAIALGLSACGGDKQAAQQPAADGAAAPAAAGAKVTAEVSGAGASFIF
PLVSKWSADYNASTGAKINYQSIGSGGGIAQIKAGTVDFGSSDKPLSSEELAQAGLAQFP
SAIGGVVPVVNIEGLEAGKLRLSGALLADIFLGKVKTWNDPAIVAANPGVKLPDGKITLV
HRSDGSGTTFNFSNYLSKVSPEWKSKVGEGTSVQWPDGVGGKGNEGVASYVKQIKGSIGY
VELAYALQNGMPFGIAFFLTEVAPRWLRGPVGTAIELLAGIPSIIYGMWGLFVLVPVMTE
YVTPFLNETLGEWPIIGPMFQGPPLGIGMLTAGFVLAIMVIPFISSVMREVFLTVPTRLK
ESAYALGSTKWEVSWDIVLPYTRSAVIGGIFLGLGRALGETMAVAFVIGNSVRLSPSLLE
PGTTIAALIANDFGEATETYRSALLLLGFVLFIVTFVGMAGINWDLFTKMTPPPMQEGGL
ANAFFGSAVMCAMAIGIGTPLGVLAGTWLAEYGNARKAGTVVRFVNDILLSAPSIVLGLF
VYTLYVMQTGGNFSAFAGALSLAFIVLPVVVRTTDEMLRLVPSQMREAALSLGIPQWKVI
VQVLYRSASAGIITGILLALARISGETAPLLFTAFGNQYWNNNIFQPMASVPVVMNQFAG
SPYESWQVLAWAGALVLTVFVLLRIAVPSSHESLHTPSPVKLAARGLDFYYDKFHALKGI
NLEIPEKRVTALIGPSGCGKSTLLRIFNRIYALYPKLEARGEVLLDGENILSPKYPMNRL
RSKVGMVFQKPVPFPMTIFENVAYGIRHHEKLSKADMADRVEQALRQGALWDEVKDKLGQ
SALGLSGGQQQLERGSALQTTAVEHGSTLQSGTTMNLPNDHIVKSYDEEQQRLVAEIVRM
GEMAVAQLEAAMDVIEKRDENAAHRIIANDEAIDALEQQISHDVMRLALRGPMARDLREI
LAGLRIPADIERIGDYAANVAKRSIALGKVPPLPQIQGLRALGRLAAQQVRRAIAAYRDN
DADAALALREDDARLDAQYTALFRELLTYMMEDPRNITPCTHLLFMAKNLERVGDHATNI
AENVWFLVHGEQPLPPREKRDETSSTGQP
Download sequence
Identical sequences jgi|PhycaF7|113160|estExt_fgenesh1_pg.C_270079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]