SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|76296|fgenesh1_pg.C_scaffold_27000061 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|PhycaF7|76296|fgenesh1_pg.C_scaffold_27000061
Domain Number - Region: 85-195
Classification Level Classification E-value
Superfamily PhoU-like 0.00641
Family PhoU-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|76296|fgenesh1_pg.C_scaffold_27000061
Sequence length 442
Sequence
MFSLQTIFGSGKQFYTLLDEAAVAASDAAKALHSMLREADRQPALDAFKLARLRERAASD
KISQALVDSFMTPIEREDIEALGSALYKIPKQIEKFADRYSLATTHLEHIDFAPRAAMLE
QAAGVVVEMVADLRHMNLDRMTALNEKLRSLENEADRLMLELYRDIYSGRLDNLQMFLLK
EFFEILEKAIDRCREAGVVAYQIVWAQNKGLLWKVFVPMITSPIAGFLLGIVVMVLLWGL
IAGLAKIGGAIGRLARPRIVNAFFGKAQIASAAYMGFAHGHNDAQKTMGIIAMTLIGAEA
TGALNDLPSWLAFMHPDAHAGDGIAMWIVLTCAVVMAAGTASGGWKIIKTLGHKMVKLHP
IHGFAAETSSATILTLAAHFGMPVSTTHSISTAIMGVGFAKNPRSLKFGVIERIVWAWIL
TIPAAGGCAYLILKLFELFGWT
Download sequence
Identical sequences jgi|PhycaF7|76296|fgenesh1_pg.C_scaffold_27000061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]