SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|76391|fgenesh1_pg.C_scaffold_4000015 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|76391|fgenesh1_pg.C_scaffold_4000015
Domain Number 1 Region: 40-226,295-423,453-515,568-695,723-955
Classification Level Classification E-value
Superfamily Porins 2.9e-71
Family Ligand-gated protein channel 0.0097
Further Details:      
 
Domain Number 2 Region: 1071-1207
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.02e-23
Family GntR ligand-binding domain-like 0.0083
Further Details:      
 
Domain Number 3 Region: 986-1059
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.7e-22
Family GntR-like transcriptional regulators 0.0064
Further Details:      
 
Domain Number 4 Region: 1859-2021,2087-2205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.97e-16
Family N-type ATP pyrophosphatases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|76391|fgenesh1_pg.C_scaffold_4000015
Sequence length 2251
Sequence
MRRSAGAVHSISLSPTPLIVALLAVLAGLPAAQAQSSRDAAGQDPTTLDQVQVTGIRESM
QSSINKKRDDTVIADVLSADDIGDLPAPSLADAIETLTGAASTRDKTGASEISIRGLGAF
LSSTNFNGREITNGSGDRSVNFNMFPAELINTVAIYKTQRADIIEGGVAGTIGLETVRPL
EYGKRSAQIDLRGSWAEYDKKYRDDDGIGYRGTASYIDQFEFGNGQKLGISLGFQRLDGT
DPEESITSGSTWYACDGTQNVGNANCNEVSAQAIANGAPYYLVPSSRIYRLKQERNDRQS
EFAALQWRPNDVVEVNLDFEHTERNWYENRSDLSLSNARRGITQREVDEDGIVRHLHGST
SIDSTSNRYWRGEEYTGGGLNLILRPTPAWELSTDLSYSHTNRLDSERMTRLRANQRDVN
NAVVPGISSGATGYVDYDWDWHGEVPSVALAPNFDPTNWDAYTGAARVTSSATENDHKIK
AGRFDASFMPESGFFTRIKGGVRASQADYRLRDNTLVTDYDQRVATDKAKIIAANQACRA
PFPQDDFMDAASGNTISSWAYFDPNCLYQSFRGSLDSRLDPGFQDPNNVDVTEKTRALYL
MGEFSSSLFGLPVTGNLGLRWVKTDVRSEGVRTGLRIEDNGDGTIRLQPTGEYSTQVFKA
GNDKLLPSLNAAFELRPDVLLRVGAYRAMSRPDIAALGAGRTINVSSDATYGNLADALDD
ISASGNPAAQPLMSWNGDLSLEWYPNPDTMLAGAVYWKQFNGGTATALVPETYTIDGQSV
TVPVRQQVTTDEDSTLTGFELTATHRLSYLPKPFDGLGFKVSYNYADADYRTQDSRLGEQ
LASDGTIIPAIVPPAGLSGFSRHVLSGSIYWDVGRFNIQAIGKFRSHYYQDFTGNTAQQN
RYYDDNTSVDLRLRYRVNKQLSLSLELMNLTNEPRVAYQPLYGNFREVVTYGRRRRGQWS
RRRSNRTLAGRGGRAGTRRESPRVSRMSANRLYQTIAAKLRKLIEDGEFPPGSRLPGERE
LAERFGVSRVTIREAEIALEAQGWIAIRIGSGVHVKPRPTQASGGLPDVSAFDLTAARAV
FEAEAAALAASNLDDAGIAELQSLAEALCRRDLSDAEAGEYDRRFHLAIARLSGNPVVEF
FVQQIWRMRSELPRVSEVYARVCHDDGASRADEHMAIFEALRARDPVAARNAMRHHFQRL
FEAMLQATESQALEEIRRRTQQDRERFMATTQRPILLHRGGQQHVGQIAVGRIGHQAGGM
AEAEPAQQVQPVRAVGQDDPAANACGADQVVAETEIDDKGVAGCAERLVTGDDHQPVDLH
HLPTAWDDARHAVHRGLAKRLLGQWPHLFGQVEDVHGIGVVCFIVMKATHQGAGFPPLLH
QHRFIKASWWATLPDEADELRQRKQALQQKGGIKAIVIDLASAEIALPRHWVREGESRGC
PPITARDVRRFLASVTRAACSRTFLPFSYTVSAARRRGQEATPGEVDLQQLALLVRVFDW
LRPIAFRKTDECFLYCLAMREFLSRYGIVPAWVFASSSGLFVMDQLAEALLDDANTEVKE
MAFTDPVMLLPKPSRQREAPNAYGTPPAKIPSPSKQQKKKKKKSPTKEAATAALLALGQG
KPSPKGAKPVTPPSTLGKRKQSSKSDDESKLKIPKPTPTPTPETDYCPYVMTDSTPPSLL
QDVEAIYRRAVNMGKTCHQLAYPWEGSKVWYDPAEEELLHVAHWRFWMANQVRFFEWQLN
MPYRSSFQRSQRRRQTALARTARLKFISQCIERWGYYGFLKLYEGMEDCLLLGVGDFNVD
WSFLSYSLLFPFRDGLQTGFEEVTALEAGEAVTIRDCRPIGRHYQWDVVRQASEAPIEDL
EEAVQLARATLLGCIGALASQHRCIQLQLSGGLDSSIVLAGLLHAPSAPEVKCVHHYDAG
IGADERMFARMAVAGASESSGRRCEFVEYQRQPHCSLEEIMDFPRTARPAHCSGYLLHRR
DVDVDADTVQFTGVGGDAVFLRFKGNAAAIDYAWRRGIDRDFFRVAFETAQSGDSLYGVF
KDAFVHGVFKKPGSINGRWGNPCEWVKVDASEQDGLPPAWLRHARAQGYRLSPHKLAHIG
RMIFPTSVLDPFEGAGRWHGVSPISAQPVVELFARLPLYLLMAGAEDRTIARRALQGLLP
QALLSRKVKSYLDDHSVAVTQRHQQFIRGLLVDGLLARRGYIDSASADAGIRRVSPDHSS
QVLGIFGPQVNIEAWLRRWMGRPGVPAAGAA
Download sequence
Identical sequences jgi|PhycaF7|76391|fgenesh1_pg.C_scaffold_4000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]