SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|77696|fgenesh1_pg.C_scaffold_6000370 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|77696|fgenesh1_pg.C_scaffold_6000370
Domain Number 1 Region: 260-521
Classification Level Classification E-value
Superfamily Outer membrane phospholipase A (OMPLA) 2.35e-90
Family Outer membrane phospholipase A (OMPLA) 0.00000437
Further Details:      
 
Domain Number 2 Region: 524-624
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.71e-20
Family ArsC-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|77696|fgenesh1_pg.C_scaffold_6000370
Sequence length 624
Sequence
MGLSFILYLLAVIFVLVGIAGIILPALPGIPLVFIGLLLAAWADGFAHVGWPTLVALGVL
TVLSLLADVLATVVGAQRVGASRKALWGTFLGSIVGLFFMPIGLFAGPLIGALLGEYWHT
RELGRSTKVGLATWLGILLGLALKLAVVIAMLGLFAFACAPLAAQEFVPSTDTTPAACAA
ITTDAARLACYDRLFAHTPQATAAADAAAEAAAQARREERQTARVSQGEEKLRERVSDLF
RPAAPDSALANAGRGSLLDSRWELAEDSKLGPFQLRAYKPVYLLPAFWTSDRNTTPHSPN
PANTVTTPQVLDSAELKFQISFKTKIAENLFGDNGDIWAGYTQSSRWQAYNGEDSRPFRE
TNYEPEVMMVFRNGYSIGGWRGRMTGIALNHQSNGRADPLSRSWNRVMLNIGLDRENWAL
VLRPWYRIPETRSDDNNPDIEDYMGRGDATLTWNRNGHEVSLMARHSLRTGSRSHGALQL
DYGFPISNLLRGHVQIFDGYGESLIDYNHKATYVGVGVSLLECNSRGALKLIRDAGFEPE
VIEYLGNPPDVATLRQVLAESGLSARDLVRSKESQFAELGLEDADEATLLASMAEHPRLI
NRPVVRTPKGTRLCRPPETVLEIL
Download sequence
Identical sequences jgi|PhycaF7|77696|fgenesh1_pg.C_scaffold_6000370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]