SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|80441|fgenesh1_pg.C_scaffold_12000356 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|80441|fgenesh1_pg.C_scaffold_12000356
Domain Number 1 Region: 789-862
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000000378
Family Reverse transcriptase 0.009
Further Details:      
 
Domain Number 2 Region: 557-667
Classification Level Classification E-value
Superfamily Acid proteases 0.0000866
Family Retroviral protease (retropepsin) 0.037
Further Details:      
 
Weak hits

Sequence:  jgi|PhycaF7|80441|fgenesh1_pg.C_scaffold_12000356
Domain Number - Region: 449-509
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0889
Family GntR ligand-binding domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|80441|fgenesh1_pg.C_scaffold_12000356
Sequence length 863
Sequence
MGSSTSGRGDQSSEEGSAKRSFLVDQYKAEEGVAATIWRAFYRCLDKTTRQLVKQDPRPR
FLEKAVEKANRIDDPIDNVARGMANAGLPFATAPSSYLAPMAGTTGQTVMIPGIGGAGLP
VEFNQVEDDTEDEGVAKRKRTPKSAAARPPTDMRRPEKKPKIKREEATTDEEAESKPQRK
KFKAAVKQAKAEETRRAQLQHASQAQREKEEEQYVSGQKEVRSCGVEGVEEAVVATADDG
AGAKTELDGRDDSEEEKEALCLPGDNTEVGAEVTSEAGGTQVTKDVRDGGVATVSGEAEA
KRTLNGRNDSGDEMSMVSTGLDGAEAEAKAASGARCARVRRSVRREGVAAFGGEAESKRT
PDDRHDLEADGLELGVPANNSEDGVEETLGASIPQISEGLEGRRGGEEGSAGIGRYGESE
QRRATDPAQKPVVDGDVKSSSGDDTDPAPSARFGTAIAHVRSVRRKARLVSKQRRAEVKR
ARQQHQQTQKKLRNKDVDEAQKAKRQHDAEVALATAAERCQKAGGEGMREPTVGGTARVS
LVKHQKQSEGPRQNEAVEYVGTDDGLPTAVMTVDDVRKDVQLDSCARYTIAGTNWMQYGD
RVDSAAPVDYVEGIGGFLLDVLGVWSFEMRTVFDEVIRVEACIVAGCTDEFLLGVDFMRE
HGATMDFSRNEVRYNEEGRVVVIPFRTQEGENNRRIAVELGTWVPVDKDMEVMATNNGMD
PSRLEQWMNELGDAETPLDNEDEVNIGTDVPKDRAMIMRLLRVYRKLSSSTSACPPTTAL
DLHHHIDTGNAAPIMLKRRRQAQTEDKIIDENVTQMLEAGVIEEGNGAWGFPVVLVRKKD
GEILVAPEDKDKTAFTTKKGLYR
Download sequence
Identical sequences jgi|PhycaF7|80441|fgenesh1_pg.C_scaffold_12000356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]